Tag or “RFID tag” means the unique identification number or Radio Frequency Identification (RFID) issued to a licensee by the agency for tracking, identifying and verifying marihuana plants, marihuana products, and packages of marihuana product in the statewide monitoring system.
Tag means the RMS device installed in the Vehicle to enable the payment of Tolls by electronic means.
Tag means a record of harvesting information attached to a container of shellstock by the harvester or proc- essor. § 123.5 § 123.5 Current good manufacturing practice.(a) Part 110 of this chapter applies in determining whether the facilities, methods, practices, and controls used to process fish and fishery products are safe, and whether these products have been processed under sanitary condi- tions.(b) The purpose of this part is to set forth requirements specific to the proc- essing of fish and fishery products.§ 123.6 Hazard analysis and Hazard Analysis Critical Control Point (HACCP) plan.(a) Hazard analysis. Every processor shall conduct, or have conducted for it, a hazard analysis to determine whether there are food safety hazards that are reasonably likely to occur for each kind of fish and fishery product proc- essed by that processor and to identify the preventive measures that the proc- essor can apply to control those haz- ards. Such food safety hazards can be introduced both within and outside the processing plant environment, includ- ing food safety hazards that can occur before, during, and after harvest. A food safety hazard that is reasonably likely to occur is one for which a pru- dent processor would establish controls because experience, illness data, sci- entific reports, or other information provide a basis to conclude that there is a reasonable possibility that it will occur in the particular type of fish or fishery product being processed in the absence of those controls.(b) The HACCP plan. Every processorshall have and implement a written HACCP plan whenever a hazard anal- ysis reveals one or more food safety hazards that are reasonably likely to occur, as described in paragraph (a) of this section. A HACCP plan shall be specific to:
Examples of Tag in a sentence
Every three months, each Party shall provide the other Party with an updated list of employees qualified for inclusion on the Joint Tag List.
Brief description of services Nature of processing Type of personal data Categories of stakeholders Purposes of processing Subprocessors Retention periods Retrieving data from websites that the website owner can use in Google Tag manager.
Either Party may request the other Party to remove an employee from the Joint Tag List in its reasonable discretion, and such other Party shall comply with such request.
More Definitions of Tag
Tag means a representation of an internal or external data value or calculation result.
Tag means to place distinct markers on wires and cables, coded by color or other means specified by the City and/or applicable federal, State or local regulations, that will readily identify the type of Attachment and its owner.
Tag means a protein or any other molecule comprising the amino acid sequence SAWSHPQFEKGGGSGGGSGGSAWSHPQFEK described in and protected by the Patent Rights (A), the use of which but for this Limited Use License would infringe one or more Valid Claims of Patent Rights (A).
Tag means a written document that is required under this Chapter to be posted conspicuously at a pretreatment or new- construction treatment site.
Tag means a type of license tag or plate for a motor vehicle or trailer that the Agency is authorized to issue or approve for issuance under the Mississippi Motor Vehicle Privilege Tax Law, Miss. Code Ann. Sections 27-19-1, et seq., or under the Motor Vehicle Dealer Tag Permit Law, Miss. Code Ann. Sections 27-19-301, et seq. The term “tag” includes personalized license tags. “Tag” does not include other types of license tags or plates issued by county tax collectors.
Tag means a card, label, or other paper-based or electronic means of identification used to document harvest of protected wildlife.
Tag means The Americas Group.